- Recombinant Pseudomonas phage phi6 Fusion protein P6 (P6)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1125040
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 17,360 Da
- E Coli or Yeast
- 2-168
- Fusion protein P6 (P6)
Sequence
SIFSSLFKVIKKVISKVVATLKKIFKKIWPLLLIVAIIYFAPYLAGFFTSAGFTGIGGIFSSIATTITPTLTSFLSTAWSGVGSLASTAWSGFQSLGMGTQLAVVSGAAALIAPEETAQLVTEIGTTVGDIAGTIIGGVAKALPGWIWIAAGGLAVWALWPSSDSKE